Speakenglishwithtiffani.com


Keyword Suggestion

Speakenglishwithtiffani.com
Speak english with tiffani
Speak english with tiffani academy
Speak english with tiffani youtube
Speak english with tiffani pdf
Speak english with tiffani podcast
Speak english with tiffani academy pdf
Speak english with tiffani app
Speak english with tiffani episode 1



Domain Informations

Speakenglishwithtiffani.com lookup results from whois.namecheap.com server:
  • Domain created: 2016-05-17T07:11:49Z
  • Domain updated: 2024-04-17T08:27:55Z
  • Domain expires: 2025-05-17T07:11:49Z 0 Years, 244 Days left
  • Website age: 8 Years, 120 Days
  • Registrar Domain ID: 2028864775_DOMAIN_COM-VRSN
  • Registrar Url: http://www.namecheap.com
  • Registrar WHOIS Server: whois.namecheap.com
  • Registrar Abuse Contact Email: [email protected]
  • Registrar Abuse Contact Phone: +1.6613102107
  • Name server:
    • NS1.BLUEHOST.COM
    • NS2.BLUEHOST.COM

Network
  • inetnum : 141.193.213.0 - 141.193.213.255
  • name : WPENG
  • handle : NET-141-193-213-0-1
  • status : Direct Allocation
  • created : 2020-03-20
  • changed : 2020-07-14
Owner
  • organization : WPEngine, Inc.
  • handle : WPENG
  • address : Array,Austin,TX,78701,US
Technical support
Abuse
Domain Provider Number Of Domains
godaddy.com 286730
namecheap.com 101387
networksolutions.com 69118
tucows.com 52617
publicdomainregistry.com 39120
whois.godaddy.com 32793
enomdomains.com 23825
namesilo.com 21429
domains.google.com 21384
cloudflare.com 20573
gmo.jp 18110
name.com 17601
fastdomain.com 14708
register.com 13495
net.cn 12481
ionos.com 12416
ovh.com 12416
gandi.net 12305
registrar.amazon.com 12111


Host Informations

  • IP address: 141.193.213.20
  • Location: United States
  • Latitude: 37.751
  • Longitude: -97.822
  • Timezone: America/Chicago

Check all domain's dns records


See Web Sites Hosted on 141.193.213.20

Fetching Web Sites Hosted


Site Inspections


Port Scanner (IP: 141.193.213.20)

 › Ftp: 21
 › Ssh: 22
 › Telnet: 23
 › Smtp: 25
 › Dns: 53
 › Http: 80
 › Pop3: 110
 › Portmapper, rpcbind: 111
 › Microsoft RPC services: 135
 › Netbios: 139
 › Imap: 143
 › Ldap: 389
 › Https: 443
 › SMB directly over IP: 445
 › Msa-outlook: 587
 › IIS, NFS, or listener RFS remote_file_sharing: 1025
 › Lotus notes: 1352
 › Sql server: 1433
 › Point-to-point tunnelling protocol: 1723
 › My sql: 3306
 › Remote desktop: 3389
 › Session Initiation Protocol (SIP): 5060
 › Virtual Network Computer display: 5900
 › X Window server: 6001
 › Webcache: 8080


Spam Check (IP: 141.193.213.20)

 › Dnsbl-1.uceprotect.net:
 › Dnsbl-2.uceprotect.net:
 › Dnsbl-3.uceprotect.net:
 › Dnsbl.dronebl.org:
 › Dnsbl.sorbs.net:
 › Spam.dnsbl.sorbs.net:
 › Bl.spamcop.net:
 › Recent.dnsbl.sorbs.net:
 › All.spamrats.com:
 › B.barracudacentral.org:
 › Bl.blocklist.de:
 › Bl.emailbasura.org:
 › Bl.mailspike.org:
 › Bl.spamcop.net:
 › Cblplus.anti-spam.org.cn:
 › Dnsbl.anticaptcha.net:
 › Ip.v4bl.org:
 › Fnrbl.fast.net:
 › Dnsrbl.swinog.ch:
 › Mail-abuse.blacklist.jippg.org:
 › Singlebl.spamgrouper.com:
 › Spam.abuse.ch:
 › Spamsources.fabel.dk:
 › Virbl.dnsbl.bit.nl:
 › Cbl.abuseat.org:
 › Dnsbl.justspam.org:
 › Zen.spamhaus.org:


Email address with speakenglishwithtiffani.com

Found 0 emails of this domain

Recent Searched Sites

0xprial.com (5 seconds ago) / US

Zirconiacrowns.ca (3 seconds ago) / US

Bahynet.com (1 seconds ago) / DE

Xmodelboard.download (5 seconds ago) / AU

Chicagohope.org (6 seconds ago) / US

Vote.union.ic.ac.uk (48 seconds ago) / GB

Nbx.com (16 seconds ago) / US

Speakenglishwithtiffani.com (0 seconds ago) / US

Dracoarmstore.com (3 seconds ago) / US

Mgzyfx.com (40 seconds ago) / CN

Swimnews.dk (0 seconds ago) / US

On.nypl.org (6 seconds ago) / US

Businesstax.santacruzcounty.us (15 seconds ago) / US

Bacolviral.com (1 mins ago) / AU

Dimitrasdishes.com (38 seconds ago) / US

Onlinecamscanner.com (27 seconds ago) / BR

Cdmdoto.com (0 seconds ago) / US

Datarade.ai (50 seconds ago) / US

Guadalupeshrine.org (8 seconds ago) / US

Rezultati.sec.mk (10 seconds ago) / US

Websites Listing

We found Websites Listing below when search with speakenglishwithtiffani.com on Search Engine

356 : Daily English Vocabulary – Book 7 | Word #10 – Divulge

Web 356 : Daily English Vocabulary – Book 7 | Word #10 – Divulge. In today’s episode, you will learn a new English vocabulary word. You will also hear a story related to today’s …

Speakenglishwithtiffani.com

357 : Daily English Vocabulary – Book 7 | Word #11 – Dogmatic

Web In today’s episode, you will learn a new English vocabulary word. You will also hear a story related to today's vocabulary word. This episode will give you the vocabulary you need to …

Speakenglishwithtiffani.com

289 : Daily English Vocabulary – Book 5 | Word #3 – Contemplate

Web In today’s episode, you will learn a new English vocabulary word. You will also hear a story related to today's vocabulary word. This episode will give you the vocabulary you need to …

Speakenglishwithtiffani.com

363: Daily English Vocabulary – Book 7 | Word #17 – Dupe

Web 363: Daily English Vocabulary – Book 7 | Word #17 – Dupe. In today’s episode, you will learn a new English vocabulary word. You will also hear a story related to today’s …

Speakenglishwithtiffani.com

255 : Daily English Vocabulary – Book 3 | Word #29 – Cantankerous

Web In today’s episode, you will learn a new English vocabulary word. You will also hear a story related to today's vocabulary word. This episode will give you the vocabulary you need to …

Speakenglishwithtiffani.com

speakenglishwithtiffaniacademy.com - Finally Speak …

Web LET'S JUMP RIGHT IN! | Speak English With Tiffani Academy LOGIN The #1 Online English Academy Find English courses and resources that will help you finally speak English fluently and with confidence. LET'S JUMP …

Speakenglishwithtiffaniacademy.com

Newsletter - Speak English with Tiffani

Web Weekly English Newsletter. Sign up here to get our weekly newsletter. You'll get free tips and discount offers.

Speakenglishwithtiffani.com

245 : Daily English Vocabulary – Book 3 | Word #18 – Bolster

Web 245 : Daily English Vocabulary – Book 3 | Word #18 – Bolster. In today’s episode, you will learn a new English vocabulary word. You will also hear a story related to today’s …

Speakenglishwithtiffani.com

Speak English With Tiffani – Speak English with Confidence

Web Speak English With Tiffani – Speak English with Confidence Get The Key to Unlock Your Advanced English Level. With this key, you will open any door in your life. Watch the …

Englishwithtiffani.com

241 : Daily English Vocabulary – Book 3 | Word #14 – Blatant

Web In today’s episode, you will learn a new English vocabulary word. You will also hear a story related to today's vocabulary word. This episode will give you the vocabulary you need to …

Speakenglishwithtiffani.com

345 : Daily English Vocabulary – Book 6 | Word #29 – …

Web 345 : Daily English Vocabulary – Book 6 | Word #29 – Disproportionate. In today’s episode, you will learn a new English vocabulary word. You will also hear a story related to today’s …

Speakenglishwithtiffani.com

Finally Speak English | Speak English With Tiffani Academy

Web Finally Speak English | Speak English With Tiffani Academy

Speakenglishwithtiffaniacademy.com

SPEAK ENGLISH WITH TIFFANI ACADEMY STUDENT | Meet Emery

Web Apr 18, 2023  · Join the family1. http://dailyenglishlessons.com/2. http://speakenglishlikeanative.com/

Youtube.com

Speak English Like A Native Speaker Episode 1 - YouTube

Web Speak English With Tiffani 225K views 1 year ago SPEAK ENGLISH LIKE A NATIVE USING THIS SIMPLE RULE Speak English With Tiffani 59K views 9 days ago 90 …

Youtube.com

Free Speak English Ebook – Speak English with Tiffani

Web Free Speak English Ebook – Speak English with Tiffani FREE ENGLISH EBOOK "TOP 3 ENGLISH RESOURCES USED BY AMERICANS IN REAL LIFE" In this exclusive ebook …

Sewt.speakenglishwithtiffani.com

English Teacher Tiffani on Instagram‎: "Study with me: www ...

Web 428 likes, 7 comments - English Teacher Tiffani (@speakenglishwithtiffani) on Instagram‎: "Study with me: www.DailyEnglishLessons.com⁠ ⁠ ‎‏#learnenglish #studyenglish …

Instagram.com

‎Speak English with Tiffani Podcast on Apple Podcasts

Web Sep 10, 2022  · 444 episodes. Welcome to the Speak English with Tiffani podcast. A podcast especially created for Intermediate and Advanced English learners. In this podcast, you …

Podcasts.apple.com


Domains Expiration Date Updated

Site Provider Expiration Date
tennisario.com namecheap.com -2 Years, -136 Days
gestpost.com godaddy.com -1 Years, -156 Days
monroegrace.com gmo.jp -1 Years, -22 Days
gresgying.com xinnet.com -2 Years, -36 Days
bizmagnet.co 1api.net -2 Years, -134 Days
mangaokutr.com porkbun.com -1 Years, -39 Days
iticsa.com godaddy.com -1 Years, -330 Days
roba3.com gmo.jp -2 Years, -88 Days
emirplast.com nicproxy.com -2 Years, -112 Days
mindchamps.org whois.wildwestdomains.com -1 Years, -34 Days

    Browser All

    .com4.3M domains   

    .org1M domains   

    .edu40.9K domains   

    .net617.2K domains   

    .gov15.9K domains   

    .us30.9K domains   

    .ca45.1K domains   

    .de560.1K domains   

    .uk466.2K domains   

    .it35K domains   

    .au46.7K domains   

    .co34.2K domains   

    .biz13.9K domains   

    .info36.4K domains   

    .fr37.6K domains   

    .eu24.7K domains   

    .ru195.7K domains   

    .ph5.6K domains   

    .in54.2K domains   

    .vn18.9K domains   

    .cn40.5K domains   

    .ro19.4K domains   

    .ch11.7K domains   

    .at10.3K domains   

    Browser All